Recombinant Full Length Human RRAS Protein
Cat.No. : | RRAS-449HF |
Product Overview : | Recombinant full length Human RRAS with N terminal proprietary tag; Predicted MWt 50.50 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 218 amino acids |
Description : | Ras-related protein R-Ras is a protein that in humans is encoded by the RRAS gene. |
Form : | Liquid |
Molecular Mass : | 50.500kDa inclusive of tags |
AA Sequence : | MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGV GKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLD ILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAF GASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP SPPSAPRKKGGGCPCVLL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | RRAS related RAS viral (r-ras) oncogene homolog [ Homo sapiens ] |
Official Symbol | RRAS |
Synonyms | RRAS; related RAS viral (r-ras) oncogene homolog; ras-related protein R-Ras; Oncogene RRAS |
Gene ID | 6237 |
mRNA Refseq | NM_006270 |
Protein Refseq | NP_006261 |
MIM | 165090 |
UniProt ID | P10301 |
◆ Recombinant Proteins | ||
RRAS-14519M | Recombinant Mouse RRAS Protein | +Inquiry |
RRAS-7809M | Recombinant Mouse RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-5180R | Recombinant Rat RRAS Protein | +Inquiry |
RRAS-2735H | Recombinant Human RRAS protein, His-tagged | +Inquiry |
RRAS-2954H | Recombinant Human RRAS protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRAS-2144HCL | Recombinant Human RRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRAS Products
Required fields are marked with *
My Review for All RRAS Products
Required fields are marked with *
0
Inquiry Basket