Recombinant Full Length Human RRAS Protein
Cat.No. : | RRAS-449HF |
Product Overview : | Recombinant full length Human RRAS with N terminal proprietary tag; Predicted MWt 50.50 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | Ras-related protein R-Ras is a protein that in humans is encoded by the RRAS gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 50.500kDa inclusive of tags |
Protein Length : | 218 amino acids |
AA Sequence : | MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGV GKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLD ILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAF GASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP SPPSAPRKKGGGCPCVLL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | RRAS related RAS viral (r-ras) oncogene homolog [ Homo sapiens ] |
Official Symbol : | RRAS |
Synonyms : | RRAS; related RAS viral (r-ras) oncogene homolog; ras-related protein R-Ras; Oncogene RRAS |
Gene ID : | 6237 |
mRNA Refseq : | NM_006270 |
Protein Refseq : | NP_006261 |
MIM : | 165090 |
UniProt ID : | P10301 |
Products Types
◆ Recombinant Protein | ||
Rras-5623M | Recombinant Mouse Rras Protein, Myc/DDK-tagged | +Inquiry |
RRAS-1920H | Recombinant Human RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-4839R | Recombinant Rat RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-7809M | Recombinant Mouse RRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS-1465Z | Recombinant Zebrafish RRAS | +Inquiry |
◆ Lysates | ||
RRAS-2144HCL | Recombinant Human RRAS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket