Recombinant Full Length Human RRAS Protein
| Cat.No. : | RRAS-449HF | 
| Product Overview : | Recombinant full length Human RRAS with N terminal proprietary tag; Predicted MWt 50.50 kDa including the tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 218 amino acids | 
| Description : | Ras-related protein R-Ras is a protein that in humans is encoded by the RRAS gene. | 
| Form : | Liquid | 
| Molecular Mass : | 50.500kDa inclusive of tags | 
| AA Sequence : | MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGV GKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLD ILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAF GASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPP SPPSAPRKKGGGCPCVLL | 
| Purity : | Proprietary Purification | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. | 
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. | 
| Gene Name | RRAS related RAS viral (r-ras) oncogene homolog [ Homo sapiens ] | 
| Official Symbol | RRAS | 
| Synonyms | RRAS; related RAS viral (r-ras) oncogene homolog; ras-related protein R-Ras; Oncogene RRAS | 
| Gene ID | 6237 | 
| mRNA Refseq | NM_006270 | 
| Protein Refseq | NP_006261 | 
| MIM | 165090 | 
| UniProt ID | P10301 | 
| ◆ Recombinant Proteins | ||
| RRAS-449HF | Recombinant Full Length Human RRAS Protein | +Inquiry | 
| RRAS-2953H | Recombinant Human RRAS protein, His-tagged | +Inquiry | 
| RRAS-2954H | Recombinant Human RRAS protein, GST-tagged | +Inquiry | 
| RRAS-1465Z | Recombinant Zebrafish RRAS | +Inquiry | 
| RRAS-7809M | Recombinant Mouse RRAS Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| RRAS-2144HCL | Recombinant Human RRAS 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRAS Products
Required fields are marked with *
My Review for All RRAS Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            