Recombinant Human SNRPF
Cat.No. : | SNRPF-30586TH |
Product Overview : | Recombinant full length Human SNRPF expressed in Saccharomyces cerevisiae; amino acids 1-86 ; 9.7kDa. |
- Specification
- Gene Information
- Related Products
Description : | Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYM NMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEE EEDGEMRE |
Gene Name : | SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ] |
Official Symbol : | SNRPF |
Synonyms : | SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; |
Gene ID : | 6636 |
mRNA Refseq : | NM_003095 |
Protein Refseq : | NP_003086 |
MIM : | 603541 |
Uniprot ID : | P62306 |
Chromosome Location : | 12q23.1 |
Pathway : | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; |
Function : | RNA binding; |
Products Types
◆ Recombinant Protein | ||
SNRPF-2715H | Recombinant Human SNRPF Protein, His-tagged | +Inquiry |
SNRPF-8540M | Recombinant Mouse SNRPF Protein, His (Fc)-Avi-tagged | +Inquiry |
Snrpf-6008M | Recombinant Mouse Snrpf Protein, Myc/DDK-tagged | +Inquiry |
SNRPF-15699M | Recombinant Mouse SNRPF Protein | +Inquiry |
SNRPF-2851H | Recombinant Human SNRPF, His-tagged | +Inquiry |
◆ Lysates | ||
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SNRPF Products
Required fields are marked with *
My Review for All SNRPF Products
Required fields are marked with *
0
Inquiry Basket