"SNRPF" Related Products

Expand
Expand

Recombinant Human SNRPF

Cat.No.: SNRPF-30586TH
Product Overview: Recombinant full length Human SNRPF expressed in Saccharomyces cerevisiae; amino acids 1-86 ; 9.7kDa.
Description: Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYM NMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEE EEDGEMRE
Gene Name: SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ]
Official Symbol: SNRPF
Synonyms: SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F;
Gene ID: 6636
mRNA Refseq: NM_003095
Protein Refseq: NP_003086
MIM: 603541
Uniprot ID: P62306
Chromosome Location: 12q23.1
Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem;
Function: RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.