Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SNRPF

Cat.No. : SNRPF-30586TH
Product Overview : Recombinant full length Human SNRPF expressed in Saccharomyces cerevisiae; amino acids 1-86 ; 9.7kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYM NMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEE EEDGEMRE
Gene Name : SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ]
Official Symbol : SNRPF
Synonyms : SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F;
Gene ID : 6636
mRNA Refseq : NM_003095
Protein Refseq : NP_003086
MIM : 603541
Uniprot ID : P62306
Chromosome Location : 12q23.1
Pathway : Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem;
Function : RNA binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All SNRPF Products

Required fields are marked with *

My Review for All SNRPF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends