Recombinant Human SNRPF protein, GST-tagged
Cat.No. : | SNRPF-1820H |
Product Overview : | Recombinant Human SNRPF protein(1-86 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-86 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ] |
Official Symbol | SNRPF |
Synonyms | SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; sm protein F; SMF; Sm-F; snRNP-F; |
Gene ID | 6636 |
mRNA Refseq | NM_003095 |
Protein Refseq | NP_003086 |
MIM | 603541 |
UniProt ID | P62306 |
◆ Recombinant Proteins | ||
SNRPF-4778C | Recombinant Chicken SNRPF | +Inquiry |
SNRPF-2851H | Recombinant Human SNRPF, His-tagged | +Inquiry |
SNRPF-30586TH | Recombinant Human SNRPF | +Inquiry |
SNRPF-1168Z | Recombinant Zebrafish SNRPF | +Inquiry |
SNRPF-2715H | Recombinant Human SNRPF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNRPF Products
Required fields are marked with *
My Review for All SNRPF Products
Required fields are marked with *
0
Inquiry Basket