"TAGLN3" Related Products

Expand

Recombinant Human TAGLN3, His-tagged

Cat.No.: TAGLN3-31441TH
Product Overview: Recombinant full length Human TAGLN3 with N terminal His tag; 219 amino acids with tag, Predicted MWt 24.6 kDa.
Description: Transgelin-3 is a protein that in humans is encoded by the TAGLN3 gene.
Protein length: 199 amino acids
Conjugation: HIS
Molecular Weight: 24.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Widely expressed in the brain. Expression is increased in the superior frontal cortex of alcoholics, but not in the motor cortex or cerebellum.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQ KYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAA ETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS NKGASQAGMTGYGMPRQIM
Sequence Similarities: Belongs to the calponin family.Contains 1 calponin-like repeat.Contains 1 CH (calponin-homology) domain.
Gene Name: TAGLN3 transgelin 3 [ Homo sapiens ]
Official Symbol: TAGLN3
Synonyms: TAGLN3; transgelin 3; transgelin-3; NP22; NP25;
Gene ID: 29114
mRNA Refseq: NM_001008272
Protein Refseq: NP_001008273
MIM: 607953
Uniprot ID: Q9UI15
Chromosome Location: 3q13.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.