Recombinant Human TAGLN3, His-tagged
Cat.No. : | TAGLN3-31441TH |
Product Overview : | Recombinant full length Human TAGLN3 with N terminal His tag; 219 amino acids with tag, Predicted MWt 24.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 199 amino acids |
Description : | Transgelin-3 is a protein that in humans is encoded by the TAGLN3 gene. |
Conjugation : | HIS |
Molecular Weight : | 24.600kDa inclusive of tags |
Tissue specificity : | Widely expressed in the brain. Expression is increased in the superior frontal cortex of alcoholics, but not in the motor cortex or cerebellum. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMANRGPSYGLSREVQEKIEQ KYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAA ETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS NKGASQAGMTGYGMPRQIM |
Sequence Similarities : | Belongs to the calponin family.Contains 1 calponin-like repeat.Contains 1 CH (calponin-homology) domain. |
Gene Name | TAGLN3 transgelin 3 [ Homo sapiens ] |
Official Symbol | TAGLN3 |
Synonyms | TAGLN3; transgelin 3; transgelin-3; NP22; NP25; |
Gene ID | 29114 |
mRNA Refseq | NM_001008272 |
Protein Refseq | NP_001008273 |
MIM | 607953 |
Uniprot ID | Q9UI15 |
Chromosome Location | 3q13.2 |
◆ Recombinant Proteins | ||
TAGLN3-16410M | Recombinant Mouse TAGLN3 Protein | +Inquiry |
TAGLN3-4429R | Recombinant Rhesus Macaque TAGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN3-3500H | Recombinant Human TAGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAGLN3-8980M | Recombinant Mouse TAGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN3-5921R | Recombinant Rat TAGLN3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAGLN3-1260HCL | Recombinant Human TAGLN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAGLN3 Products
Required fields are marked with *
My Review for All TAGLN3 Products
Required fields are marked with *
0
Inquiry Basket