Recombinant Human TAGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TAGLN3-3500H
Product Overview : TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008273) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TAGLN3 (Transgelin 3) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include actin filament binding. An important paralog of this gene is TAGLN2.
Molecular Mass : 22.5 kDa
AA Sequence : MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TAGLN3 transgelin 3 [ Homo sapiens (human) ]
Official Symbol TAGLN3
Synonyms TAGLN3; transgelin 3; transgelin-3; NP22; NP25; neuronal protein 22; neuronal protein NP25;
Gene ID 29114
mRNA Refseq NM_001008272
Protein Refseq NP_001008273
MIM 607953
UniProt ID Q9UI15

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAGLN3 Products

Required fields are marked with *

My Review for All TAGLN3 Products

Required fields are marked with *

0
cart-icon