Recombinant Human USP17L2

Cat.No. : USP17L2-28070TH
Product Overview : Recombinant fragment of Human Dub3 (amino acids 431-530) with proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Broadly expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
Sequence Similarities : Belongs to the peptidase C19 family. USP17 subfamily.
Gene Name USP17L2 ubiquitin specific peptidase 17-like 2 [ Homo sapiens ]
Official Symbol USP17L2
Synonyms USP17L2; ubiquitin specific peptidase 17-like 2; ubiquitin carboxyl-terminal hydrolase 17-like protein 2; deubiquitinating enzyme 3; DUB3;
Gene ID 377630
mRNA Refseq NM_201402
Protein Refseq NP_958804
MIM 610186
Uniprot ID Q6R6M4
Chromosome Location 8p23.1
Function cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity; ubiquitin-specific protease activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All USP17L2 Products

Required fields are marked with *

My Review for All USP17L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon