"USP17L2" Related Products

Recombinant Human USP17L2

Cat.No.: USP17L2-28070TH
Product Overview: Recombinant fragment of Human Dub3 (amino acids 431-530) with proprietary tag, 36.63kDa.
Description: DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Broadly expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
Sequence Similarities: Belongs to the peptidase C19 family. USP17 subfamily.
Gene Name: USP17L2 ubiquitin specific peptidase 17-like 2 [ Homo sapiens ]
Official Symbol: USP17L2
Synonyms: USP17L2; ubiquitin specific peptidase 17-like 2; ubiquitin carboxyl-terminal hydrolase 17-like protein 2; deubiquitinating enzyme 3; DUB3;
Gene ID: 377630
mRNA Refseq: NM_201402
Protein Refseq: NP_958804
MIM: 610186
Uniprot ID: Q6R6M4
Chromosome Location: 8p23.1
Function: cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity; ubiquitin-specific protease activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.