Recombinant Human USP17L2
| Cat.No. : | USP17L2-28070TH |
| Product Overview : | Recombinant fragment of Human Dub3 (amino acids 431-530) with proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Broadly expressed. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ |
| Sequence Similarities : | Belongs to the peptidase C19 family. USP17 subfamily. |
| Gene Name | USP17L2 ubiquitin specific peptidase 17-like 2 [ Homo sapiens ] |
| Official Symbol | USP17L2 |
| Synonyms | USP17L2; ubiquitin specific peptidase 17-like 2; ubiquitin carboxyl-terminal hydrolase 17-like protein 2; deubiquitinating enzyme 3; DUB3; |
| Gene ID | 377630 |
| mRNA Refseq | NM_201402 |
| Protein Refseq | NP_958804 |
| MIM | 610186 |
| Uniprot ID | Q6R6M4 |
| Chromosome Location | 8p23.1 |
| Function | cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity; ubiquitin-specific protease activity; |
| ◆ Recombinant Proteins | ||
| USP17L2-28070TH | Recombinant Human USP17L2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP17L2 Products
Required fields are marked with *
My Review for All USP17L2 Products
Required fields are marked with *
Recently Viewed
