Recombinant Human VAC14, His-tagged

• Cat.No.: VAC14-29818TH
• Product Overview: Recombinant fragment, corresponding to amino acids 640-782 of Human VAC14 with N terminal His tag; 143 amino acids, 18kDa.

Specification

• Description: The content of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) in endosomal membranes changes dynamically with fission and fusion events that generate or absorb intracellular transport vesicles. VAC14 is a component of a trimolecular complex that tightly regulates the level of PtdIns(3,5)P2. Other components of this complex are the PtdIns(3,5)P2-synthesizing enzyme PIKFYVE (MIM 609414) and the PtdIns(3,5)P2 phosphatase FIG4 (MIM 609390). VAC14 functions as an activator of PIKFYVE (Sbrissa et al.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Ubiquitously expressed.
• Form: Lyophilised:Reconstitute with 82 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QNYRHAYDLIQKFGDLEVTVDFLAEVDKLVQLIECPIFTY LRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRL QCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHF EKVQNKHLEVRHQRSGRGDHLDRRVVL
• Sequence Similarities: Belongs to the VAC14 family.Contains 6 HEAT repeats.

Gene Information

• Gene Name: VAC14 Vac14 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: VAC14
• Synonyms: VAC14; Vac14 homolog (S. cerevisiae); Tax1 (human T cell leukemia virus type I) binding protein 2 , TAX1BP2; protein VAC14 homolog; ArPIKfyve; FLJ10305
• Gene ID: 55697
• mRNA Refseq: NM_018052
• Protein Refseq: NP_060522
• MIM: 604632
• Uniprot ID: Q08AM6
• Chromosome Location: 16q22.1
• Pathway: HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: binding; receptor activity