Recombinant Human ULBP1 Protein (Gly26-Pro215), C-Fc-tagged
Cat.No. : | VAC14-03H |
Product Overview : | Human VAC14 partial ORF ( NP_060522.3, 714 a.a. - 782 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 714-782 |
Description : | This gene encodes a scaffold protein that is a component of the PIKfyve protein kinase complex. This complex is responsible for the synthesis of phosphatidylinositol 3,5-bisphosphate, an important component of cellular membranes, from phosphatidylinositol 3-phosphate. Mice lacking a functional copy of this gene exhibit severe neurodegeneration. Mutations in the human gene have been identified in patients with a childhood onset progressive neurological disorder characterized by impaired movement, dystonia, and striatal abnormalities. |
Molecular Mass : | 33.33 kDa |
AA Sequence : | SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | VAC14 VAC14 component of PIKFYVE complex [ Homo sapiens (human) ] |
Official Symbol | VAC14 |
Synonyms | VAC14; VAC14 component of PIKFYVE complex; TRX; TAX1BP2; ArPIKfyve; protein VAC14 homolog; Vac14, PIKFYVE complex component |
Gene ID | 55697 |
mRNA Refseq | NM_018052 |
Protein Refseq | NP_060522 |
MIM | 604632 |
UniProt ID | Q08AM6 |
◆ Recombinant Proteins | ||
VAC14-9988M | Recombinant Mouse VAC14 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAC14-2331H | Recombinant Human VAC14 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAC14-03H | Recombinant Human ULBP1 Protein (Gly26-Pro215), C-Fc-tagged | +Inquiry |
VAC14-6490R | Recombinant Rat VAC14 Protein | +Inquiry |
VAC14-29818TH | Recombinant Human VAC14, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAC14-1901HCL | Recombinant Human VAC14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAC14 Products
Required fields are marked with *
My Review for All VAC14 Products
Required fields are marked with *
0
Inquiry Basket