Recombinant Human ULBP1 Protein (Gly26-Pro215), C-Fc-tagged

Cat.No. : VAC14-03H
Product Overview : Human VAC14 partial ORF ( NP_060522.3, 714 a.a. - 782 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 714-782
Description : This gene encodes a scaffold protein that is a component of the PIKfyve protein kinase complex. This complex is responsible for the synthesis of phosphatidylinositol 3,5-bisphosphate, an important component of cellular membranes, from phosphatidylinositol 3-phosphate. Mice lacking a functional copy of this gene exhibit severe neurodegeneration. Mutations in the human gene have been identified in patients with a childhood onset progressive neurological disorder characterized by impaired movement, dystonia, and striatal abnormalities.
Molecular Mass : 33.33 kDa
AA Sequence : SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name VAC14 VAC14 component of PIKFYVE complex [ Homo sapiens (human) ]
Official Symbol VAC14
Synonyms VAC14; VAC14 component of PIKFYVE complex; TRX; TAX1BP2; ArPIKfyve; protein VAC14 homolog; Vac14, PIKFYVE complex component
Gene ID 55697
mRNA Refseq NM_018052
Protein Refseq NP_060522
MIM 604632
UniProt ID Q08AM6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VAC14 Products

Required fields are marked with *

My Review for All VAC14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon