"NOG" Related Products

Expand
Expand

Recombinant Human NOG protein

Cat.No. : NOG-21H
Product Overview : Recombinant Human NOG protein was expressed in Escherichia coli.
Description : Noggin encoded by the NOG gene, was first isolated from Xenopus, having the function of inducing secondary axis formation in frog embryos. It inhibits TGF-β family ligands and preventing them from binding to their corresponding receptors. Noggin was originally found as a BMP-4 antagonist, and then has been shown to modulate the activities of other BMPs (BMP-2, 7, 13 and 14). Additionally, it has pleiotropic effect, both in early development and later stages. The results of the mouse knockout of noggin suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. In recent report, proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) have relation with the mutant of evolutionarily conserved amino acid residues of Noggin. Mature human Noggin shares 99 %, 99 %, 98 %, 97 % and 89 % a.a. sequence identity with mouse, rat, bovine, equine and chicken Noggin, respectively.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % acetonitrile, 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 3.0 ng/ml, corresponding to a specific activity of > 3.3 × 105 IU/mg in the presence of 5 ng/ml rHuBMP-4.
Molecular Mass : Approximately 46.3 kDa, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
Protein length : 206
AA Sequence : MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Endotoxin : Less than 1 EU/μg of rHuNoggin as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : NOG
Official Symbol : NOG
Synonyms : NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1;
Gene ID : 9241
mRNA Refseq : NM_005450
Protein Refseq : NP_005441
MIM : 602991
UniProt ID : Q13253

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.