Recombinant Active Mouse IL21 Protein, His-tagged(C-ter)
Cat.No. : | Il21-175M |
Product Overview : | Recombinant Active Mouse IL21 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Form : | Powder |
Bio-activity : | Determined by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 |
AA Sequence : | MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il21 interleukin 21 [ Mus musculus ] |
Official Symbol | Il21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL-21; |
Gene ID | 60505 |
mRNA Refseq | NM_021782 |
Protein Refseq | NP_068554 |
◆ Recombinant Proteins | ||
IL21-5818H | Recombinant Human IL21 protein, His-tagged | +Inquiry |
Il21-001H | Active Recombinant Human Il21, HIgG1 Fc-tagged, mutant | +Inquiry |
IL21-2926H | Recombinant Human IL21 Protein (Leu23-Ser162), C-His tagged | +Inquiry |
IL21-006H | Active Recombinant Human IL21, HIgG1 Fc-tagged, mutant | +Inquiry |
IL21-2927H | Recombinant Human IL21 Protein (Gln23-Ser155), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket