Recombinant Active Mouse IL9 Protein, His-tagged(N-ter)

Cat.No. : Il9-219M
Product Overview : Recombinant Active Mouse IL9 Protein with His tag (N-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]
Source : E. coli
Species : Mouse
Tag : His
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 10^6 IU/mg.
AA Sequence : QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Il9 interleukin 9 [ Mus musculus ]
Official Symbol Il9
Synonyms IL9; interleukin 9; interleukin-9; cytokine P40; T-cell growth factor P40; P40; Il-9;
Gene ID 16198
mRNA Refseq NM_008373
Protein Refseq NP_032399

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL9 Products

Required fields are marked with *

My Review for All IL9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon