Recombinant Active Pig CSF2 Protein, His-tagged(N-ter)
Cat.No. : | CSF2-50P |
Product Overview : | Recombinant Active Pig CSF2 Protein with His tag (N-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 3 ng/mL. |
AA Sequence : | APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Sus scrofa ] |
Official Symbol | CSF2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; GM-CSF; |
Gene ID | 397208 |
mRNA Refseq | NM_214118 |
Protein Refseq | NP_999283 |
◆ Recombinant Proteins | ||
CSF2-106S | Recombinant Swine CSF2 | +Inquiry |
GM-CSF-3367M | Recombinant Mouse GM-CSF protein, His-tagged | +Inquiry |
CSF2-374P | Recombinant Pig Colony Stimulating Factor 2 (granulocyte-macrophage) | +Inquiry |
CSF2-4386F | Recombinant Feline CSF2 Protein | +Inquiry |
CSF2-1729C | Recombinant Chicken CSF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2 Products
Required fields are marked with *
My Review for All CSF2 Products
Required fields are marked with *
0
Inquiry Basket