Recombinant Human Csf2 protein, His-tagged
Cat.No. : | Csf2-1321M |
Product Overview : | Recombinant Human Csf2 protein(18-100 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-100 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQT |
Gene Name | CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ] |
Official Symbol | Csf2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897; |
Gene ID | 1437 |
mRNA Refseq | NM_000758 |
Protein Refseq | NP_000749 |
MIM | 138960 |
UniProt ID | P04141 |
◆ Recombinant Proteins | ||
Csf2-7177M | Recombinant Mouse Csf2 Protein | +Inquiry |
CSF2-2384M | Recombinant Mouse CSF2 protein(Ala18-Lys141), hFc-tagged | +Inquiry |
Csf2-609M | Active Recombinant Mouse Csf2 Protein | +Inquiry |
CSF2-85H | Recombinant Human GMCSF, His-tagged | +Inquiry |
Csf2-045M | Active Recombinant Mouse Csf2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Csf2 Products
Required fields are marked with *
My Review for All Csf2 Products
Required fields are marked with *