Recombinant C. suffusus Beta-mammal toxin Css4 Protein, His-SUMO-tagged

Cat.No. : SCX4-1142C
Product Overview : Recombinant Centruroides suffusus Beta-mammal toxin Css4 Protein (1-66 aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : C.suffusus
Source : E.coli
Tag : His&SUMO
Protein Length : 1-66 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 23.6 kDa
AA Sequence : KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Beta-mammal toxin Css4
Official Symbol Beta-mammal toxin Css4
Synonyms Beta-mammal toxin Css4; Css IV; CssIV
UniProt ID P60266

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Beta-mammal toxin Css4 Products

Required fields are marked with *

My Review for All Beta-mammal toxin Css4 Products

Required fields are marked with *

0
cart-icon