Recombinant C. suffusus Beta-mammal toxin Css4 Protein, His-SUMO-tagged
| Cat.No. : | SCX4-1142C |
| Product Overview : | Recombinant Centruroides suffusus Beta-mammal toxin Css4 Protein (1-66 aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | C.suffusus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-66 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 23.6 kDa |
| AA Sequence : | KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Beta-mammal toxin Css4 |
| Official Symbol | Beta-mammal toxin Css4 |
| Synonyms | Beta-mammal toxin Css4; Css IV; CssIV |
| UniProt ID | P60266 |
| ◆ Recombinant Proteins | ||
| SCX4-1142C | Recombinant C. suffusus Beta-mammal toxin Css4 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Beta-mammal toxin Css4 Products
Required fields are marked with *
My Review for All Beta-mammal toxin Css4 Products
Required fields are marked with *
