"CXCL2" Related Products

Expand
Expand

Recombinant CXCL2 Protein, His-Flag-StrepII-tagged

Cat.No. : CXCL2-2165P
Product Overview : Purified CXCL2 (NP_002080.1, 35 a.a. - 107 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Description : This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]
Source : Human cells
Species : Human
Tag : His-Flag-StrepII
Form : Liquid
Bio-activity : Not Tested
Molecular Mass : 13.31 kDa
AA Sequence : APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Applications : Western Blot
Enzyme-linked Immunoabsorbent Assay
SDS-PAGE
Protein Interaction
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : ≥ 10 μg/ml
Storage Buffer : 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Quality Control Testing: :

SDS-PAGE

Gene Name : CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
Official Symbol : CXCL2
Synonyms : CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a;
Gene ID : 2920
mRNA Refseq : NM_002089
Protein Refseq : NP_002080
MIM : 139110
UniProt ID : P19875

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.