Recombinant Human CXCL2 protein
Cat.No. : | CXCL2-476H |
Product Overview : | Recombinant Human CXCL2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 73 |
Description : | CXCL2, also named GRO-β, is belonging to the CXC chemokine family. It is encoded by the gene CXCL2 in humans. CXCL2/GRO-β shares 90 % amino acid sequence with CXCL1/GRO-α. All three human GROs (GRO-α, GRO-β, GRO-γ) are members of the intercrine alpha (chemokine C-X-C) subfamily of chemokine. This chemokine is secreted by monocytes and macrophages. The functional receptor for CXCL2 has been identified as CXCR2. CXCL2 is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. Similar to other GRO proteins, CXCL2 is potent neutrophil attractants and activators. In addition, it is also active toward basophils. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : | APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Endotoxin : | Less than 1 EU/µg of rHuGRO-β/CXCL2 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL2 |
Official Symbol | CXCL2 |
Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a; |
Gene ID | 2920 |
mRNA Refseq | NM_002089 |
Protein Refseq | NP_002080 |
MIM | 139110 |
UniProt ID | P19875 |
◆ Recombinant Proteins | ||
CXCL2-135H | Active Recombinant Human CXCL2 Protein (Ala35-Asn107), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL2-401H | Recombinant Human CXCL2 Protein (Ala35-Asn107) | +Inquiry |
CXCL2-1426H | Recombinant Human CXCL2 protein, His-GST & Myc-tagged | +Inquiry |
Cxcl2-387C | Active Recombinant Rat Cxcl2 Protein (69 aa) | +Inquiry |
CXCL2-1348R | Recombinant Rat CXCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL2 Products
Required fields are marked with *
My Review for All CXCL2 Products
Required fields are marked with *
0
Inquiry Basket