Active Recombinant Mouse Cxcl2 Protein
| Cat.No. : | Cxcl2-2395M |
| Product Overview : | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 2 (Cxcl2) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. |
| Bio-activity : | Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL. |
| Molecular Mass : | 7.8 kDa |
| AA Sequence : | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
| Gene Name | Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus (house mouse) ] |
| Official Symbol | Cxcl2 |
| Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a |
| Gene ID | 20310 |
| mRNA Refseq | NM_009140 |
| Protein Refseq | NP_033166 |
| UniProt ID | P10889 |
| ◆ Recombinant Proteins | ||
| CXCL2-14H | Recombinant Human CXCL2 Protein, Biotin-tagged | +Inquiry |
| Cxcl2-387C | Active Recombinant Rat Cxcl2 Protein (69 aa) | +Inquiry |
| CXCL2-885H | Recombinant Horse CXCL2 Protein, His-tagged | +Inquiry |
| CXCL2-3781H | Recombinant Human CXCL2 protein, rFc-tagged | +Inquiry |
| CXCL2-401H | Recombinant Human CXCL2 Protein (Ala35-Asn107) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl2 Products
Required fields are marked with *
My Review for All Cxcl2 Products
Required fields are marked with *
