Active Recombinant Mouse Cxcl2 Protein

Cat.No. : Cxcl2-2395M
Product Overview : Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 2 (Cxcl2) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.
Bio-activity : Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL.
Molecular Mass : 7.8 kDa
AA Sequence : AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus (house mouse) ]
Official Symbol Cxcl2
Synonyms CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a
Gene ID 20310
mRNA Refseq NM_009140
Protein Refseq NP_033166
UniProt ID P10889

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl2 Products

Required fields are marked with *

My Review for All Cxcl2 Products

Required fields are marked with *

0
cart-icon