Active Recombinant Mouse Cxcl2 Protein

• Cat.No.: Cxcl2-2395M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 2 (Cxcl2) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.
• Bio-activity: Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL.
• Molecular Mass: 7.8 kDa
• AA Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a
• Gene ID: 20310
• mRNA Refseq: NM_009140
• Protein Refseq: NP_033166
• UniProt ID: P10889