Recombinant Full Length Human APEX1 Protein, C-Flag-tagged
Cat.No. : | APEX1-2021HFL |
Product Overview : | Recombinant Full Length Human APEX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways : | Base excision repair |
Full Length : | Full L. |
Gene Name | APEX1 apurinic/apyrimidinic endodeoxyribonuclease 1 [ Homo sapiens (human) ] |
Official Symbol | APEX1 |
Synonyms | APE; APX; APE1; APEN; APEX; HAP1; REF1 |
Gene ID | 328 |
mRNA Refseq | NM_080648.3 |
Protein Refseq | NP_542379.1 |
MIM | 107748 |
UniProt ID | P27695 |
◆ Recombinant Proteins | ||
APEX1-2021HFL | Recombinant Full Length Human APEX1 Protein, C-Flag-tagged | +Inquiry |
APEX1-677H | Recombinant Human APEX1 protein, GST-tagged | +Inquiry |
Apex1-623M | Recombinant Mouse Apex1 Protein, MYC/DDK-tagged | +Inquiry |
APEX1-0348H | Recombinant Human APEX1 Protein (Pro2-Leu318), Tag Free | +Inquiry |
APEX1-4100C | Recombinant Chicken APEX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
APEX1-8796HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APEX1 Products
Required fields are marked with *
My Review for All APEX1 Products
Required fields are marked with *
0
Inquiry Basket