Recombinant Full Length Human BAG3 Protein, C-Flag-tagged
Cat.No. : | BAG3-343HFL |
Product Overview : | Recombinant Full Length Human BAG3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.4 kDa |
AA Sequence : | MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPS REGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRG MPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPV IHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSP ARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKP VSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTI LEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATS NPSSMTDTPGNPAAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | BAG3 BAG cochaperone 3 [ Homo sapiens (human) ] |
Official Symbol | BAG3 |
Synonyms | BIS; MFM6; BAG-3; CAIR-1 |
Gene ID | 9531 |
mRNA Refseq | NM_004281.4 |
Protein Refseq | NP_004272.2 |
MIM | 603883 |
UniProt ID | O95817 |
◆ Recombinant Proteins | ||
BAG3-0227H | Recombinant Human BAG3 Protein (Gly421-Ala498), N-GST-tagged | +Inquiry |
Bag3-33M | Recombinant Mouse Bag3 protein, His-tagged | +Inquiry |
BAG3-2138H | Recombinant Human BAG3 Protein, MYC/DDK-tagged | +Inquiry |
BAG3-16H | Recombinant Human BAG3 Protein, His-tagged | +Inquiry |
Bag3-34M | Recombinant Mouse Bag3 protein, His/SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAG3-56HCL | Recombinant Human BAG3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAG3 Products
Required fields are marked with *
My Review for All BAG3 Products
Required fields are marked with *
0
Inquiry Basket