Recombinant Full Length Human COX4I1 Protein

• Cat.No.: COX4I1-90HF
• Product Overview: Recombinant full length, Human COX IV with proprietary tag, Predicted MW 44.33 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 169 amino acids
• Description: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3 of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it.
• Form: Liquid
• Molecular Mass: 44.330kDa inclusive of tags
• AA Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ]
• Official Symbol: COX4I1
• Synonyms: COX4I1; cytochrome c oxidase subunit IV isoform 1; COX4, cytochrome c oxidase subunit IV; cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4 1
• Gene ID: 1327
• mRNA Refseq: NM_001861
• Protein Refseq: NP_001852
• MIM: 123864
• UniProt ID: P13073