Recombinant Full Length Human COX4I1 Protein
Cat.No. : | COX4I1-90HF |
Product Overview : | Recombinant full length, Human COX IV with proprietary tag, Predicted MW 44.33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 169 amino acids |
Description : | Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3 of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. |
Form : | Liquid |
Molecular Mass : | 44.330kDa inclusive of tags |
AA Sequence : | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ] |
Official Symbol | COX4I1 |
Synonyms | COX4I1; cytochrome c oxidase subunit IV isoform 1; COX4, cytochrome c oxidase subunit IV; cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4 1 |
Gene ID | 1327 |
mRNA Refseq | NM_001861 |
Protein Refseq | NP_001852 |
MIM | 123864 |
UniProt ID | P13073 |
◆ Recombinant Proteins | ||
COX4I1-26361TH | Recombinant Human COX4I1 | +Inquiry |
COX4I1-2290C | Recombinant Chicken COX4I1 | +Inquiry |
RFL22307BF | Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial(Cox4I1) Protein, His-Tagged | +Inquiry |
COX4I1-812R | Recombinant Rhesus Macaque COX4I1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX4I1-987R | Recombinant Rhesus monkey COX4I1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX4I1 Products
Required fields are marked with *
My Review for All COX4I1 Products
Required fields are marked with *
0
Inquiry Basket