Recombinant Full Length Human DLX3 Protein
Cat.No. : | DLX3-123HF |
Product Overview : | Recombinant full length Human DLX3 with N terminal proprietary tag, predicted mwt: 57.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 287 amino acids |
Description : | Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. |
Form : | Liquid |
Molecular Mass : | 57.310kDa inclusive of tags |
AA Sequence : | MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDL GYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAY SPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVR MVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERA ELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPN NSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSAS PSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP PNPGAVY |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | DLX3 distal-less homeobox 3 [ Homo sapiens ] |
Official Symbol | DLX3 |
Synonyms | DLX3; distal-less homeobox 3; distal less homeo box 3; homeobox protein DLX-3 |
Gene ID | 1747 |
mRNA Refseq | NM_005220 |
Protein Refseq | NP_005211 |
MIM | 600525 |
UniProt ID | O60479 |
◆ Recombinant Proteins | ||
DLX3-2482H | Recombinant human DLX3, His-tagged | +Inquiry |
DLX3-26675TH | Recombinant Human DLX3 | +Inquiry |
DLX3-2693H | Recombinant Human DLX3 Protein, GST-tagged | +Inquiry |
DLX3-4004HF | Recombinant Full Length Human DLX3 Protein, GST-tagged | +Inquiry |
DLX3-123HF | Recombinant Full Length Human DLX3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX3-6906HCL | Recombinant Human DLX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLX3 Products
Required fields are marked with *
My Review for All DLX3 Products
Required fields are marked with *
0
Inquiry Basket