Recombinant Human DLX3
Cat.No. : | DLX3-26675TH |
Product Overview : | Recombinant full length Human DLX3 with N terminal proprietary tag, predicted mwt: 57.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 287 amino acids |
Description : | Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. |
Molecular Weight : | 57.310kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDL GYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAY SPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVR MVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERA ELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPN NSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSAS PSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP PNPGAVY |
Sequence Similarities : | Belongs to the distal-less homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | DLX3 distal-less homeobox 3 [ Homo sapiens ] |
Official Symbol | DLX3 |
Synonyms | DLX3; distal-less homeobox 3; distal less homeo box 3; homeobox protein DLX-3; |
Gene ID | 1747 |
mRNA Refseq | NM_005220 |
Protein Refseq | NP_005211 |
MIM | 600525 |
Uniprot ID | O60479 |
Chromosome Location | 17q21.33 |
Function | sequence-specific DNA binding transcription factor activity; transcription regulatory region sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
DLX3-26675TH | Recombinant Human DLX3 | +Inquiry |
DLX3-774H | Recombinant Human DLX3 Protein, GST-His-tagged | +Inquiry |
DLX3-6367C | Recombinant Chicken DLX3 | +Inquiry |
DLX3-2482H | Recombinant human DLX3, His-tagged | +Inquiry |
DLX3-2405M | Recombinant Mouse DLX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX3-6906HCL | Recombinant Human DLX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLX3 Products
Required fields are marked with *
My Review for All DLX3 Products
Required fields are marked with *
0
Inquiry Basket