Recombinant Rat Gstp1 protein, His-tagged
Cat.No. : | Gstp1-3003R |
Product Overview : | Recombinant Rat Gstp1 protein(P04906)(2-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-210aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.3 kDa |
AA Sequence : | PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Gstp1 glutathione S-transferase pi 1 [ Rattus norvegicus ] |
Official Symbol | Gstp1 |
Synonyms | GSTP1; glutathione S-transferase pi 1; glutathione S-transferase P; GST 7-7; chain 7; GST class-pi; glutathione S-transferase pi 2; glutathione S-transferase, pi 2; glutathione-S-transferase, pi 1; Glutathione-S-transferase placental enzyme pi type; Glutathione-S-transferase, placental enzyme pi type; Gst3; Gstp; GST-P; Gstp2; MGC72668; MGC72669; |
Gene ID | 24426 |
mRNA Refseq | NM_012577 |
Protein Refseq | NP_036709 |
◆ Recombinant Proteins | ||
GSTP1-1215H | Recombinant Human GSTP1 protein, GST-tagged | +Inquiry |
GSTP1-7339M | Recombinant Mouse GSTP1 Protein | +Inquiry |
GSTP1-3367HF | Recombinant Full Length Human GSTP1 Protein, GST-tagged | +Inquiry |
GSTP1-3001H | Recombinant Human GSTP1 protein(2-210aa), 6xHis-tagged | +Inquiry |
Gstp1-2222H | Recombinant Hamster Gstp1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gstp1 Products
Required fields are marked with *
My Review for All Gstp1 Products
Required fields are marked with *