Recombinant Human GSTP1 protein(2-210aa), 10xHis-tagged
| Cat.No. : | GSTP1-3000H |
| Product Overview : | Recombinant Human GSTP1 protein(2-210aa)(P09211), fused with N-terminal 10xHis tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-210aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Gene Name | GSTP1 glutathione S-transferase pi 1 [ Homo sapiens ] |
| Official Symbol | GSTP1 |
| Synonyms | GSTP1; glutathione S-transferase pi 1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; deafness, X-linked 7; fatty acid ethyl ester synthase III; PI; DFN7; GST3; FAEES3 |
| Gene ID | 2950 |
| mRNA Refseq | NM_000852 |
| Protein Refseq | NP_000843 |
| MIM | 134660 |
| UniProt ID | P09211 |
| ◆ Recombinant Proteins | ||
| GSTP1-1202HFL | Recombinant Full Length Human GSTP1 Protein, C-Flag-tagged | +Inquiry |
| GSTP1-540M | Recombinant Mouse GSTP1 Protein (2-210 aa), His-SUMO-tagged | +Inquiry |
| Gstp1-29M | Recombinant Mouse Gstp1 protein, His-tagged | +Inquiry |
| GSTP1-3367HF | Recombinant Full Length Human GSTP1 Protein, GST-tagged | +Inquiry |
| GSTP1-3999H | Recombinant Human GSTP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTP1 Products
Required fields are marked with *
My Review for All GSTP1 Products
Required fields are marked with *
