Recombinant Full Length Human HSPB8 Protein, C-Flag-tagged
Cat.No. : | HSPB8-2016HFL |
Product Overview : | Recombinant Full Length Human HSPB8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | HSPB8 heat shock protein family B (small) member 8 [ Homo sapiens (human) ] |
Official Symbol | HSPB8 |
Synonyms | H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22 |
Gene ID | 26353 |
mRNA Refseq | NM_014365.3 |
Protein Refseq | NP_055180.1 |
MIM | 608014 |
UniProt ID | Q9UJY1 |
◆ Recombinant Proteins | ||
HSPB8-5120H | Recombinant Human HSPB8 Protein, GST-tagged | +Inquiry |
HSPB8-1991R | Recombinant Rhesus Macaque HSPB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPB8-165H | Recombinant Human HSPB8 protein, His/MBP-tagged | +Inquiry |
HSPB8-2954R | Recombinant Rat HSPB8 Protein | +Inquiry |
HSPB8-2016HFL | Recombinant Full Length Human HSPB8 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB8-5345HCL | Recombinant Human HSPB8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB8 Products
Required fields are marked with *
My Review for All HSPB8 Products
Required fields are marked with *
0
Inquiry Basket