Recombinant Full Length Human INMT Protein, C-Flag-tagged
Cat.No. : | INMT-1894HFL |
Product Overview : | Recombinant Full Length Human INMT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream MINDY4 (aka FAM188B) gene. In rodents and other mammals such as cetartiodactyla this gene is in the opposite orientation compared to its orientation in human and other primates and this gene appears to have been lost in carnivora and chiroptera. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.7 kDa |
AA Sequence : | MKGGFTGGDEYQKHFLPRDYLATYYSFNGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQ VLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLK CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKRE FSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Tryptophan metabolism |
Full Length : | Full L. |
Gene Name | INMT indolethylamine N-methyltransferase [ Homo sapiens (human) ] |
Official Symbol | INMT |
Synonyms | TEMT |
Gene ID | 11185 |
mRNA Refseq | NM_006774.5 |
Protein Refseq | NP_006765.4 |
MIM | 604854 |
UniProt ID | O95050 |
◆ Recombinant Proteins | ||
INMT-1184H | Recombinant Human INMT Protein, His (Fc)-Avi-tagged | +Inquiry |
INMT-99R | Recombinant Rabbit INMT Protein, His-tagged | +Inquiry |
INMT-3771H | Recombinant Human INMT protein, GST-tagged | +Inquiry |
INMT-115H | Recombinant Human INMT, GST-tagged | +Inquiry |
INMT-5114H | Recombinant Human INMT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INMT Products
Required fields are marked with *
My Review for All INMT Products
Required fields are marked with *
0
Inquiry Basket