Recombinant Human INMT protein, GST-tagged
Cat.No. : | INMT-3771H |
Product Overview : | Recombinant Human INMT protein(67-263 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 67-263 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | TIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | INMT indolethylamine N-methyltransferase [ Homo sapiens ] |
Official Symbol | INMT |
Synonyms | INMT; indolethylamine N-methyltransferase; amine N-methyltransferase; nicotine N-methyltransferase; arylamine N-methyltransferase; indolamine N-methyltransferase; aromatic alkylamine N-methyltransferase; MGC125940; MGC125941; |
Gene ID | 11185 |
mRNA Refseq | NM_001199219 |
Protein Refseq | NP_001186148 |
MIM | 604854 |
UniProt ID | O95050 |
◆ Recombinant Proteins | ||
INMT-8217M | Recombinant Mouse INMT Protein | +Inquiry |
INMT-104R | Recombinant Rat INMT Protein, His-tagged | +Inquiry |
INMT-1184H | Recombinant Human INMT Protein, His (Fc)-Avi-tagged | +Inquiry |
INMT-99R | Recombinant Rabbit INMT Protein, His-tagged | +Inquiry |
INMT-3771H | Recombinant Human INMT protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INMT Products
Required fields are marked with *
My Review for All INMT Products
Required fields are marked with *
0
Inquiry Basket