Recombinant Full Length Human Interferon-Induced Transmembrane Protein 2(Ifitm2) Protein, His-Tagged
Cat.No. : | RFL19603HF |
Product Overview : | Recombinant Full Length Human Interferon-induced transmembrane protein 2(IFITM2) Protein (Q01629) (1-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-132) |
Form : | Lyophilized powder |
AA Sequence : | MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWS LFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILL IIIPVLVVQAQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IFITM2 |
Synonyms | IFITM2; Interferon-induced transmembrane protein 2; Dispanin subfamily A member 2c; DSPA2c; Interferon-inducible protein 1-8D |
UniProt ID | Q01629 |
◆ Recombinant Proteins | ||
Ifitm2-1646M | Recombinant Mouse Ifitm2 Protein, His-tagged | +Inquiry |
IFITM2-14072H | Recombinant Human IFITM2, GST-tagged | +Inquiry |
IFITM2-3504H | Recombinant Human IFITM2 protein, His-tagged | +Inquiry |
RFL427MF | Recombinant Full Length Mouse Interferon-Induced Transmembrane Protein 2(Ifitm2) Protein, His-Tagged | +Inquiry |
IFITM2-001H | Recombinant Human IFITM2 Protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFITM2-5282HCL | Recombinant Human IFITM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFITM2 Products
Required fields are marked with *
My Review for All IFITM2 Products
Required fields are marked with *
0
Inquiry Basket