Recombinant Full Length Human LDHB Protein, GST-tagged

Cat.No. : LDHB-6968HF
Product Overview : Recombinant Human full-length LDHB(1 a.a. - 334 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 334 amino acids
Description : This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Molecular Mass : 62.48 kDa
AA Sequence : MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQT PKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWK LSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDS ENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG LTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LDHB lactate dehydrogenase B [ Homo sapiens (human) ]
Official Symbol LDHB
Synonyms LDHB; lactate dehydrogenase B; LDH-H; TRG-5; L-lactate dehydrogenase B chain; LDH-B; LDH heart subunit; OTTHUMP00000165231; renal carcinoma antigen NY-REN-46; EC 1.1.1.27
Gene ID 3945
mRNA Refseq NM_001174097
Protein Refseq NP_001167568
MIM 150100
UniProt ID P07195

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDHB Products

Required fields are marked with *

My Review for All LDHB Products

Required fields are marked with *

0
cart-icon