Active Recombinant Human LDHB Protein, His tagged
| Cat.No. : | LDHB-2570H |
| Product Overview : | Active Recombinant Human LDHB Protein with His tag was expressed in E. coli. |
| Availability | August 17, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-334 aa |
| Description : | This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13. |
| Form : | Sterile 20mM Tris, 10% Glycerol, 1mM DTT, pH8.0 |
| Bio-activity : | Specific activity is 105 unit/mg, in which one unit will convert 1.0 μmole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37 centigrade. |
| Molecular Mass : | 39 kDa |
| AASequence : | MGSSHHHHHHSSGLVPRGSHMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by Bradford |
| Gene Name | LDHB lactate dehydrogenase B [ Homo sapiens (human) ] |
| Official Symbol | LDHB |
| Synonyms | LDHB; lactate dehydrogenase B; L-lactate dehydrogenase B chain; LDH heart subunit; lactate dehydrogenase H chain; renal carcinoma antigen NY-REN-46; LDH-B; LDH-H; LDHBD; TRG-5 |
| Gene ID | 3945 |
| mRNA Refseq | NM_001174097 |
| Protein Refseq | NP_001167568 |
| MIM | 150100 |
| UniProt ID | P07195 |
| ◆ Recombinant Proteins | ||
| LDHB-3370R | Recombinant Rat LDHB Protein | +Inquiry |
| LDHB-2309R | Recombinant Rhesus Macaque LDHB Protein, His (Fc)-Avi-tagged | +Inquiry |
| LDHB-6968HF | Recombinant Full Length Human LDHB Protein, GST-tagged | +Inquiry |
| LDHB-424H | Recombinant Human LDHB Protein, MYC/DDK-tagged | +Inquiry |
| LDHB-82C | Recombinant Chicken Lactate Dehydrogenase B | +Inquiry |
| ◆ Native Proteins | ||
| LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
| LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
| LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
| LDH2-8340H | Native Human LDH2 | +Inquiry |
| LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LDHB-4788HCL | Recombinant Human LDHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHB Products
Required fields are marked with *
My Review for All LDHB Products
Required fields are marked with *



