Active Recombinant Human LDHB Protein, His tagged

Cat.No. : LDHB-2570H
Product Overview : Active Recombinant Human LDHB Protein with His tag was expressed in E. coli.
Availability September 08, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-334 aa
Description : This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13.
Form : Sterile 20mM Tris, 10% Glycerol, 1mM DTT, pH8.0
Bio-activity : Specific activity is 105 unit/mg, in which one unit will convert 1.0 μmole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37 centigrade.
Molecular Mass : 39 kDa
AASequence : MGSSHHHHHHSSGLVPRGSHMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by Bradford
Gene Name LDHB lactate dehydrogenase B [ Homo sapiens (human) ]
Official Symbol LDHB
Synonyms LDHB; lactate dehydrogenase B; L-lactate dehydrogenase B chain; LDH heart subunit; lactate dehydrogenase H chain; renal carcinoma antigen NY-REN-46; LDH-B; LDH-H; LDHBD; TRG-5
Gene ID 3945
mRNA Refseq NM_001174097
Protein Refseq NP_001167568
MIM 150100
UniProt ID P07195

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDHB Products

Required fields are marked with *

My Review for All LDHB Products

Required fields are marked with *

0
cart-icon
0
compare icon