Active Recombinant Human LDHB Protein, His tagged

• Cat.No.: LDHB-2570H
• Product Overview: Active Recombinant Human LDHB Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-334 aa
• Description: This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13.
• Form: Sterile 20mM Tris, 10% Glycerol, 1mM DTT, pH8.0
• Bio-activity: Specific activity is 105 unit/mg, in which one unit will convert 1.0 μmole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37 centigrade.
• Molecular Mass: 39 kDa
• AASequence: MGSSHHHHHHSSGLVPRGSHMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by Bradford

Gene Information

• Gene Name: LDHB lactate dehydrogenase B [ Homo sapiens (human) ]
• Official Symbol: LDHB
• Synonyms: LDHB; lactate dehydrogenase B; L-lactate dehydrogenase B chain; LDH heart subunit; lactate dehydrogenase H chain; renal carcinoma antigen NY-REN-46; LDH-B; LDH-H; LDHBD; TRG-5
• Gene ID: 3945
• mRNA Refseq: NM_001174097
• Protein Refseq: NP_001167568
• MIM: 150100
• UniProt ID: P07195