Recombinant Full Length Human LTC4S Protein, GST-tagged
Cat.No. : | LTC4S-6209HF |
Product Overview : | Human LTC4S full-length ORF ( NP_665874.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 150 amino acids |
Description : | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq |
Molecular Mass : | 43 kDa |
AA Sequence : | MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LTC4S leukotriene C4 synthase [ Homo sapiens ] |
Official Symbol | LTC4S |
Synonyms | LTC4S; leukotriene C4 synthase; MGC33147; LTC4 synthase; |
Gene ID | 4056 |
mRNA Refseq | NM_145867 |
Protein Refseq | NP_665874 |
MIM | 246530 |
UniProt ID | Q16873 |
◆ Recombinant Proteins | ||
RFL3248BF | Recombinant Full Length Bovine Leukotriene C4 Synthase(Ltc4S) Protein, His-Tagged | +Inquiry |
LTC4S-1326H | Recombinant Human LTC4S Protein, His (Fc)-Avi-tagged | +Inquiry |
LTC4S-9352M | Recombinant Mouse LTC4S Protein | +Inquiry |
Ltc4s-3863M | Recombinant Mouse Ltc4s Protein, Myc/DDK-tagged | +Inquiry |
LTC4S-3502R | Recombinant Rat LTC4S Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTC4S-668HCL | Recombinant Human LTC4S cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTC4S Products
Required fields are marked with *
My Review for All LTC4S Products
Required fields are marked with *
0
Inquiry Basket