Recombinant Full Length Human LTC4S Protein, GST-tagged

Cat.No. : LTC4S-6209HF
Product Overview : Human LTC4S full-length ORF ( NP_665874.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 150 amino acids
Description : The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq
Molecular Mass : 43 kDa
AA Sequence : MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LTC4S leukotriene C4 synthase [ Homo sapiens ]
Official Symbol LTC4S
Synonyms LTC4S; leukotriene C4 synthase; MGC33147; LTC4 synthase;
Gene ID 4056
mRNA Refseq NM_145867
Protein Refseq NP_665874
MIM 246530
UniProt ID Q16873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTC4S Products

Required fields are marked with *

My Review for All LTC4S Products

Required fields are marked with *

0

Inquiry Basket

cartIcon