Recombinant Full Length Human MT2A Protein, GST-tagged
Cat.No. : | MT2A-7000HF |
Product Overview : | Recombinant Human full-length MT2A(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 61 amino acids |
Description : | Metallothionein-2 is a protein that in humans is encoded by the MT2A gene. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MT2A metallothionein 2A [ Homo sapiens (human) ] |
Official Symbol | MT2A |
Synonyms | MT2A; MT2; metallothionein 2A; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II |
Gene ID | 4502 |
mRNA Refseq | NM_005953 |
Protein Refseq | NP_005944 |
MIM | 156360 |
UniProt ID | P02795 |
◆ Recombinant Proteins | ||
Mt2A-1898R | Recombinant Rat Mt2A protein, His & GST-tagged | +Inquiry |
MT2A-7000HF | Recombinant Full Length Human MT2A Protein, GST-tagged | +Inquiry |
MT2A-1071H | Recombinant Human MT2A, GST-tagged | +Inquiry |
MT2A-2888R | Recombinant Rhesus monkey MT2A Protein, His-tagged | +Inquiry |
MT2A-1200HFL | Recombinant Full Length Human MT2A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT2A Products
Required fields are marked with *
My Review for All MT2A Products
Required fields are marked with *