Recombinant Human MT2A, GST-tagged

Cat.No. : MT2A-1071H
Product Overview : Recombinant Human MT2A(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Metallothionein-2 is a protein that in humans is encoded by the MT2A gene.
Molecular Mass : 32.4 kDa
AA Sequence : MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MT2A metallothionein 2A [ Homo sapiens (human) ]
Official Symbol MT2A
Synonyms MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II
Gene ID 4502
mRNA Refseq NM_005953
Protein Refseq NP_005944
MIM 156360
UniProt ID P02795
Chromosome Location 16q13
Pathway Cytokine Signaling in Immune system; Immune System; Interferon gamma signaling
Function drug binding; protein binding; zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT2A Products

Required fields are marked with *

My Review for All MT2A Products

Required fields are marked with *

0
cart-icon