Recombinant Human MT2A, GST-tagged
Cat.No. : | MT2A-1071H |
Product Overview : | Recombinant Human MT2A(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Metallothionein-2 is a protein that in humans is encoded by the MT2A gene. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MT2A metallothionein 2A [ Homo sapiens (human) ] |
Official Symbol | MT2A |
Synonyms | MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II |
Gene ID | 4502 |
mRNA Refseq | NM_005953 |
Protein Refseq | NP_005944 |
MIM | 156360 |
UniProt ID | P02795 |
Chromosome Location | 16q13 |
Pathway | Cytokine Signaling in Immune system; Immune System; Interferon gamma signaling |
Function | drug binding; protein binding; zinc ion binding |
◆ Recombinant Proteins | ||
MT2A-1446H | Recombinant Human MT2A Protein, His (Fc)-Avi-tagged | +Inquiry |
MT2A-1071H | Recombinant Human MT2A, GST-tagged | +Inquiry |
MT2A-2888R | Recombinant Rhesus monkey MT2A Protein, His-tagged | +Inquiry |
MT2A-4615H | Recombinant Human MT2A Protein (Met1-Ala61), N-GST tagged | +Inquiry |
MT2A-3250H | Recombinant Human MT2A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT2A Products
Required fields are marked with *
My Review for All MT2A Products
Required fields are marked with *
0
Inquiry Basket