| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second polymorphic arylamine N-acetyltransferase gene (NAT1), is located near this gene (NAT2). |
| Form : |
50 mM Tris-HCl, pH 8.0, 8 M urea. |
| Molecular Mass : |
33.4 kDa |
| AA Sequence : |
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI |
| Purity : |
> 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Notes : |
For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Stability : |
Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : |
Store at -80 centigrade. |
| Concentration : |
>50 ug/mL as determined by microplate BCA method. |
| Protein Families : |
Transmembrane |
| Protein Pathways : |
Caffeine metabolism, Drug metabolism - other enzymes, Metabolic pathways |
| Full Length : |
Full L. |
