Recombinant Full Length Human NAT2 Protein, N-His-tagged

Cat.No. : NAT2-35HFL
Product Overview : Recombinant Full Length Human NAT2 Protein, fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second polymorphic arylamine N-acetyltransferase gene (NAT1), is located near this gene (NAT2).
Form : 50 mM Tris-HCl, pH 8.0, 8 M urea.
Molecular Mass : 33.4 kDa
AA Sequence : MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Protein Families : Transmembrane
Protein Pathways : Caffeine metabolism, Drug metabolism - other enzymes, Metabolic pathways
Full Length : Full L.
Gene Name NAT2 N-acetyltransferase 2 [ Homo sapiens (human) ]
Official Symbol NAT2
Synonyms AAC2; PNAT; NAT-2
Gene ID 10
mRNA Refseq NM_000015.3
Protein Refseq NP_000006.2
MIM 612182
UniProt ID P11245

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAT2 Products

Required fields are marked with *

My Review for All NAT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon