Recombinant Full Length Human NAT2 Protein, N-His-tagged
Cat.No. : | NAT2-35HFL |
Product Overview : | Recombinant Full Length Human NAT2 Protein, fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second polymorphic arylamine N-acetyltransferase gene (NAT1), is located near this gene (NAT2). |
Form : | 50 mM Tris-HCl, pH 8.0, 8 M urea. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Protein Families : | Transmembrane |
Protein Pathways : | Caffeine metabolism, Drug metabolism - other enzymes, Metabolic pathways |
Full Length : | Full L. |
Gene Name | NAT2 N-acetyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | NAT2 |
Synonyms | AAC2; PNAT; NAT-2 |
Gene ID | 10 |
mRNA Refseq | NM_000015.3 |
Protein Refseq | NP_000006.2 |
MIM | 612182 |
UniProt ID | P11245 |
◆ Recombinant Proteins | ||
NAT2-2949R | Recombinant Rhesus monkey NAT2 Protein, His-tagged | +Inquiry |
NAT2-2061H | Recombinant Human NAT2 Protein (1-290 aa), His-SUMO-tagged | +Inquiry |
NAT2-2769R | Recombinant Rhesus Macaque NAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAT2-3566R | Recombinant Rat NAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nat2-3654M | Recombinant Mouse Nat2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT2-1169HCL | Recombinant Human NAT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAT2 Products
Required fields are marked with *
My Review for All NAT2 Products
Required fields are marked with *
0
Inquiry Basket