Recombinant Human NAT2 Protein (1-290 aa), His-SUMO-tagged
Cat.No. : | NAT2-2061H |
Product Overview : | Recombinant Human NAT2 Protein (1-290 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-290 aa |
Description : | Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | NAT2 N-acetyltransferase 2 (arylamine N-acetyltransferase) [ Homo sapiens ] |
Official Symbol | NAT2 |
Synonyms | NAT2; AAC2; N-acetyltransferase type 2; PNAT; NAT-2; |
Gene ID | 10 |
mRNA Refseq | NM_000015 |
Protein Refseq | NP_000006 |
MIM | 612182 |
UniProt ID | P11245 |
◆ Recombinant Proteins | ||
NAT2-2061H | Recombinant Human NAT2 Protein (1-290 aa), His-SUMO-tagged | +Inquiry |
Nat2-3654M | Recombinant Mouse Nat2, His-tagged | +Inquiry |
NAT2-2949R | Recombinant Rhesus monkey NAT2 Protein, His-tagged | +Inquiry |
NAT2-406R | Recombinant Rat Nat2 Protein, His/GST-tagged | +Inquiry |
NAT2-29721TH | Recombinant Full Length Human NAT2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT2-1169HCL | Recombinant Human NAT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT2 Products
Required fields are marked with *
My Review for All NAT2 Products
Required fields are marked with *