Recombinant Full Length Human PDK1 Protein, C-Flag-tagged
Cat.No. : | PDK1-1424HFL |
Product Overview : | Recombinant Full Length Human PDK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.1 kDa |
AA Sequence : | MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNA CEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTD TVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSP SHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAV PLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW CVPSREPKDMTTFRSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Fc epsilon RI signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway |
Full Length : | Full L. |
Gene Name | PDK1 pyruvate dehydrogenase kinase 1 [ Homo sapiens (human) ] |
Official Symbol | PDK1 |
Synonyms | mitochondrial pyruvate dehydrogenase kinase isoenzyme 1; pyruvate dehydrogenase kinase, isoenzyme 1; pyruvate dehydrogenase kinase, isozyme 1 |
Gene ID | 5163 |
mRNA Refseq | NM_002610.5 |
Protein Refseq | NP_002601.1 |
MIM | 602524 |
UniProt ID | Q15118 |
◆ Recombinant Proteins | ||
PDK1-4857H | Recombinant Human PDK1 Protein (Tyr233-Met430), N-His tagged | +Inquiry |
Pdk1-2329M | Recombinant Mouse Pdk1 protein, His-tagged | +Inquiry |
PDK1-1424HFL | Recombinant Full Length Human PDK1 Protein, C-Flag-tagged | +Inquiry |
PDK1-6607M | Recombinant Mouse PDK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDK1-30240TH | Recombinant Human PDK1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDK1-603HCL | Recombinant Human PDK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDK1 Products
Required fields are marked with *
My Review for All PDK1 Products
Required fields are marked with *
0
Inquiry Basket