| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
19-149 aa |
| Description : |
Enables growth factor activity. Involved in positive regulation of cell population proliferation. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Biomarker of several diseases, including artery disease (multiple); autoimmune disease of musculoskeletal system (multiple); epilepsy (multiple); limited scleroderma; and pancreatic endocrine carcinoma. |
| Form : |
Liquid |
| AASequence : |
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR |
| Molecular Mass : |
15.5 kDa (137aa) |
| Bio-activity : |
Measured by its binding ability in a functional ELISA with Human VEGFR1/Flt-1. |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 90% by SDS-PAGE |
| Application : |
SDS-PAGE, Bioactivity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
| Reference : |
1. Hauser, S. and H.A. Weich (1993) Growth Factors. 9:259-268.
2. Maglione, D., et al, (1993) Oncogene. 8:925-931.
3. Roncal, C., et al, (2010) Cardiovasc. Res. 86:29-36. |