Recombinant Human ACTA2
Cat.No. : | ACTA2-27340TH |
Product Overview : | Recombinant full length Human alpha smooth muscle Actin with a proprietary tag at N terminal; MWt 67.21 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 377 amino acids |
Description : | The protein encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Defects in this gene cause aortic aneurysm familial thoracic type 6. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Molecular Weight : | 67.210kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVG RPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGII TNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANR EKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSG DGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTER GYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL EKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHE TTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKE ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW ISKQEYDEAGPSIVHRKCF |
Sequence Similarities : | Belongs to the actin family. |
Gene Name | ACTA2 actin, alpha 2, smooth muscle, aorta [ Homo sapiens ] |
Official Symbol | ACTA2 |
Synonyms | ACTA2; actin, alpha 2, smooth muscle, aorta; actin, aortic smooth muscle; ACTSA; |
Gene ID | 59 |
mRNA Refseq | NM_001141945 |
Protein Refseq | NP_001135417 |
MIM | 102620 |
Uniprot ID | P62736 |
Chromosome Location | 10q22-q24 |
Pathway | Muscle contraction, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; |
◆ Recombinant Proteins | ||
ACTA2-220R | Recombinant Rhesus monkey ACTA2 Protein, His-tagged | +Inquiry |
ACTA2-11898Z | Recombinant Zebrafish ACTA2 | +Inquiry |
ACTA2-05HF | Recombinant Full Length Human ACTA2 Protein | +Inquiry |
ACTA2-2890C | Recombinant Chicken ACTA2 | +Inquiry |
ACTA2-212H | Recombinant Human ACTA2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTA2-9066HCL | Recombinant Human ACTA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTA2 Products
Required fields are marked with *
My Review for All ACTA2 Products
Required fields are marked with *