Recombinant Human AIMP1, StrepII-tagged
Cat.No. : | AIMP1-245H |
Product Overview : | Purified, full-length human recombinant AIMP1 protein or Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (amino acids 1-312, 312 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 9.3 kDa. (Accession NP_0047 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 1-312, 312 a.a. |
Description : | AIMP-1 is the non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEI LAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | AIMP1 aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 [ Homo sapiens ] |
Official Symbol | AIMP1 |
Synonyms | AIMP1; aminoacyl tRNA synthetase complex-interacting multifunctional protein 1; SCYE1, small inducible cytokine subfamily E, member 1 (endothelial monocyte activating); aminoacyl tRNA synthase complex-interacting multifunctional protein 1; ARS interacting multifunctional protein 1; EMAP II; EMAP 2; EMAPII; p43; ARS-interacting multifunctional protein 1; endothelial monocyte-activating polypeptide 2; multisynthase complex auxiliary component p43; endothelial-monocyte activating polypeptide II; multisynthetase complex auxiliary component p43; small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating); HLD3; EMAP2; SCYE1; |
Gene ID | 9255 |
mRNA Refseq | NM_001142415 |
Protein Refseq | NP_001135887 |
MIM | 603605 |
UniProt ID | Q12904 |
Chromosome Location | 4q24 |
Pathway | Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem; |
Function | cell surface binding; cytokine activity; protein homodimerization activity; tRNA binding; |
◆ Cell & Tissue Lysates | ||
AIMP1-578HCL | Recombinant Human AIMP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIMP1 Products
Required fields are marked with *
My Review for All AIMP1 Products
Required fields are marked with *
0
Inquiry Basket