Recombinant Human AKR1C1 Protein, GST-tagged
Cat.No. : | AKR1C1-411H |
Product Overview : | Human AKR1C1 full-length ORF ( NP_001344.2, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 63.2 kDa |
AA Sequence : | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKR1C1 aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) [ Homo sapiens ] |
Official Symbol | AKR1C1 |
Synonyms | AKR1C1; aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase); DDH1; aldo-keto reductase family 1 member C1; DD1; DDH; HAKRC; MBAB; aldo-keto reductase C; indanol dehydrogenase; dihydrodiol dehydrogenase 1; dihydrodiol dehydrogenase 1/2; hepatic dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRC; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; dihydrodiol dehydrogenase isoform DD1; type II 3-alpha-hydroxysteroid dehydrogenase; high-affinity hepatic bile acid-binding protein; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; C9; H-37; HBAB; DD1/DD2; 2-ALPHA-HSD; 20-ALPHA-HSD; MGC8954; |
Gene ID | 1645 |
mRNA Refseq | NM_001353 |
Protein Refseq | NP_001344 |
MIM | 600449 |
UniProt ID | Q04828 |
◆ Recombinant Proteins | ||
AKR1C1-293R | Recombinant Rhesus monkey AKR1C1 Protein, His-tagged | +Inquiry |
AKR1C1-27156TH | Recombinant Human AKR1C1, His-tagged | +Inquiry |
AKR1C1-2028H | Recombinant Human AKR1C1, His-tagged | +Inquiry |
AKR1C1-27157TH | Recombinant Human AKR1C1, His-tagged | +Inquiry |
AKR1C1-39C | Recombinant Cynomolgus Monkey AKR1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C1-48HCL | Recombinant Human AKR1C1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1C1 Products
Required fields are marked with *
My Review for All AKR1C1 Products
Required fields are marked with *
0
Inquiry Basket