Recombinant Human AKR1C1, His-tagged
Cat.No. : | AKR1C1-27156TH |
Product Overview : | Recombinant full length Human AKR1C1 (amino acids 1-323) with N terminal His tag; 343aa, 38.9kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 323 amino acids |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. |
Conjugation : | HIS |
Molecular Weight : | 38.900kDa inclusive of tags |
Tissue specificity : | Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain. |
Biological activity : | Specific activity: approximately 0.15 - 0.2 units/mg.Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 20% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMDSKYQCVKLNDGHFMPVLG FGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALE RSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD TVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALG SHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ LQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN RNVRYLTLDIFAGPPNYPFSDEY |
Sequence Similarities : | Belongs to the aldo/keto reductase family. |
Gene Name | AKR1C1 aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) [ Homo sapiens ] |
Official Symbol | AKR1C1 |
Synonyms | AKR1C1; aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase); DDH1; aldo-keto reductase family 1 member C1; DD1; DDH; HAKRC; MBAB; |
Gene ID | 1645 |
mRNA Refseq | NM_001353 |
Protein Refseq | NP_001344 |
MIM | 600449 |
Uniprot ID | Q04828 |
Chromosome Location | 10p15-p14 |
Pathway | Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem; |
Function | 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity; aldo-keto reductase (NADP) activity; androsterone dehydrogenase (B-specific) activity; bile acid binding; carboxylic acid binding; |
◆ Recombinant Proteins | ||
AKR1C1-1366HF | Recombinant Full Length Human AKR1C1 Protein, GST-tagged | +Inquiry |
AKR1C1-411H | Recombinant Human AKR1C1 Protein, GST-tagged | +Inquiry |
AKR1C1-27157TH | Recombinant Human AKR1C1, His-tagged | +Inquiry |
AKR1C1-121R | Recombinant Rhesus Macaque AKR1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C1-39C | Recombinant Cynomolgus Monkey AKR1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C1-48HCL | Recombinant Human AKR1C1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1C1 Products
Required fields are marked with *
My Review for All AKR1C1 Products
Required fields are marked with *
0
Inquiry Basket