Recombinant Human AMELY protein(17-102aa), His&Myc-tagged
| Cat.No. : | AMELY-9173H |
| Product Overview : | Recombinant Human AMELY protein(Q99218)(17-102aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 17-102aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPV |
| Gene Name | AMELY amelogenin, Y-linked [ Homo sapiens ] |
| Official Symbol | AMELY |
| Synonyms | Amelogenin (Y chromosome); Amelogenin; Amelogenin Y isoform; Amelogenin Y linked; AMELY; AMELY_HUMAN; AMGL; AMGY; Y isoform; AMELY |
| Gene ID | 266 |
| mRNA Refseq | NM_001143.1 |
| Protein Refseq | NP_001134.1 |
| MIM | 410000 |
| UniProt ID | Q99218 |
| ◆ Recombinant Proteins | ||
| AMELY-1503HFL | Recombinant Full Length Human AMELY protein, Flag-tagged | +Inquiry |
| AMELY-9173H | Recombinant Human AMELY protein(17-102aa), His&Myc-tagged | +Inquiry |
| AMELY-9645H | Recombinant Human AMELY protein, MYC/DDK-tagged | +Inquiry |
| AMELY-7644H | Recombinant Human AMELY protein, His-tagged | +Inquiry |
| AMELY-9613H | Recombinant Human AMELY, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMELY Products
Required fields are marked with *
My Review for All AMELY Products
Required fields are marked with *
