Recombinant Human AMELY Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AMELY-457H |
Product Overview : | AMELY MS Standard C13 and N15-labeled recombinant protein (NP_001134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta. |
Molecular Mass : | 21.73 kDa |
AA Sequence : | MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AMELY amelogenin Y-linked [ Homo sapiens (human) ] |
Official Symbol | AMELY |
Synonyms | Amelogenin (Y chromosome); Amelogenin; Amelogenin Y isoform; Amelogenin Y linked; AMELY; AMELY_HUMAN; AMGL; AMGY; Y isoform; AMELY |
Gene ID | 266 |
mRNA Refseq | NM_001143 |
Protein Refseq | NP_001134 |
MIM | 410000 |
UniProt ID | Q99218 |
◆ Recombinant Proteins | ||
AMELY-9645H | Recombinant Human AMELY protein, MYC/DDK-tagged | +Inquiry |
AMELY-1503HFL | Recombinant Full Length Human AMELY protein, Flag-tagged | +Inquiry |
AMELY-9613H | Recombinant Human AMELY, GST-tagged | +Inquiry |
AMELY-7644H | Recombinant Human AMELY protein, His-tagged | +Inquiry |
AMELY-457H | Recombinant Human AMELY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMELY Products
Required fields are marked with *
My Review for All AMELY Products
Required fields are marked with *