Recombinant Human AMELY Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AMELY-457H
Product Overview : AMELY MS Standard C13 and N15-labeled recombinant protein (NP_001134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.
Molecular Mass : 21.73 kDa
AA Sequence : MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AMELY amelogenin Y-linked [ Homo sapiens (human) ]
Official Symbol AMELY
Synonyms Amelogenin (Y chromosome); Amelogenin; Amelogenin Y isoform; Amelogenin Y linked; AMELY; AMELY_HUMAN; AMGL; AMGY; Y isoform; AMELY
Gene ID 266
mRNA Refseq NM_001143
Protein Refseq NP_001134
MIM 410000
UniProt ID Q99218

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMELY Products

Required fields are marked with *

My Review for All AMELY Products

Required fields are marked with *

0

Inquiry Basket

cartIcon