Recombinant Human ANXA11 protein(291-370 aa), C-His-tagged

• Cat.No.: ANXA11-2781H
• Product Overview: Recombinant Human ANXA11 protein(P50995)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 291-370 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGEN

Gene Information

• Gene Name: ANXA11 annexin A11 [ Homo sapiens ]
• Official Symbol: ANXA11
• Synonyms: ANXA11; annexin A11; ANX11; CAP-50; annexin XI; annexin-11; 56 kDa autoantigen; autoantigen, 56-kD; calcyclin-associated annexin 50; CAP50
• Gene ID: 311
• mRNA Refseq: NM_001157
• Protein Refseq: NP_001148
• MIM: 602572
• UniProt ID: P50995