Recombinant Human ANXA11 protein(291-370 aa), C-His-tagged
| Cat.No. : | ANXA11-2781H |
| Product Overview : | Recombinant Human ANXA11 protein(P50995)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli. |
| Availability | February 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-370 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGEN |
| Gene Name | ANXA11 annexin A11 [ Homo sapiens ] |
| Official Symbol | ANXA11 |
| Synonyms | ANXA11; annexin A11; ANX11; CAP-50; annexin XI; annexin-11; 56 kDa autoantigen; autoantigen, 56-kD; calcyclin-associated annexin 50; CAP50; |
| Gene ID | 311 |
| mRNA Refseq | NM_001157 |
| Protein Refseq | NP_001148 |
| MIM | 602572 |
| UniProt ID | P50995 |
| ◆ Recombinant Proteins | ||
| ANXA11-2781H | Recombinant Human ANXA11 protein(291-370 aa), C-His-tagged | +Inquiry |
| ANXA11-26349TH | Recombinant Human ANXA11, His-tagged | +Inquiry |
| ANXA11-343H | Recombinant Human ANXA11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANXA11-1047HF | Recombinant Full Length Human ANXA11 Protein, GST-tagged | +Inquiry |
| ANXA11-0423H | Recombinant Human ANXA11 Protein (Met1-Asp505), N-His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ANXA11-6905H | Recombinant Human ANXA11 Protein, Avi tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANXA11-8836HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
| ANXA11-8837HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA11 Products
Required fields are marked with *
My Review for All ANXA11 Products
Required fields are marked with *
