Recombinant Human ANXA11 protein(291-370 aa), C-His-tagged

Cat.No. : ANXA11-2781H
Product Overview : Recombinant Human ANXA11 protein(P50995)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli.
Availability February 06, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 291-370 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 11.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGEN
Gene Name ANXA11 annexin A11 [ Homo sapiens ]
Official Symbol ANXA11
Synonyms ANXA11; annexin A11; ANX11; CAP-50; annexin XI; annexin-11; 56 kDa autoantigen; autoantigen, 56-kD; calcyclin-associated annexin 50; CAP50;
Gene ID 311
mRNA Refseq NM_001157
Protein Refseq NP_001148
MIM 602572
UniProt ID P50995

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANXA11 Products

Required fields are marked with *

My Review for All ANXA11 Products

Required fields are marked with *

0
cart-icon
0
compare icon