Recombinant Human ANXA11 protein, GST-tagged
Cat.No. : | ANXA11-629H |
Product Overview : | Human ANXA11 full-length ORF ( AAH07564, 1 a.a. - 505 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 81.29 kDa |
AA Sequence : | MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTRDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANXA11 annexin A11 [ Homo sapiens ] |
Official Symbol | ANXA11 |
Synonyms | ANXA11; annexin A11; ANX11; CAP-50; annexin XI; annexin-11; 56 kDa autoantigen; autoantigen, 56-kD; calcyclin-associated annexin 50; CAP50; |
Gene ID | 311 |
mRNA Refseq | NM_001157 |
Protein Refseq | NP_001148 |
MIM | 602572 |
UniProt ID | P50995 |
◆ Recombinant Proteins | ||
ANXA11-1121HFL | Recombinant Full Length Human ANXA11 Protein, C-Flag-tagged | +Inquiry |
ANXA11-343H | Recombinant Human ANXA11 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANXA11-2118C | Recombinant Chicken ANXA11 | +Inquiry |
ANXA11-629H | Recombinant Human ANXA11 protein, GST-tagged | +Inquiry |
Anxa11-3493M | Recombinant Mouse Anxa11, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA11-8837HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
ANXA11-8836HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA11 Products
Required fields are marked with *
My Review for All ANXA11 Products
Required fields are marked with *
0
Inquiry Basket