Recombinant Human ANXA5 protein, GST-tagged
Cat.No. : | ANXA5-635H |
Product Overview : | Human ANXA5 full-length ORF ( AAH01429, 1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 60.94 kDa |
AA Sequence : | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANXA5 annexin A5 [ Homo sapiens ] |
Official Symbol | ANXA5 |
Synonyms | ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2; |
Gene ID | 308 |
mRNA Refseq | NM_001154 |
Protein Refseq | NP_001145 |
MIM | 131230 |
UniProt ID | P08758 |
◆ Recombinant Proteins | ||
ANXA5-0429H | Recombinant Human ANXA5 Protein (Met1-Asp320), N-His-tagged | +Inquiry |
ANXA5-2606H | Recombinant Human ANXA5 protein(11-200 aa), C-His-tagged | +Inquiry |
ANXA5-26600TH | Recombinant Human ANXA5 protein, His-tagged | +Inquiry |
ANXA5-635H | Recombinant Human ANXA5 protein, GST-tagged | +Inquiry |
ANXA5-1521HF | Recombinant Full Length Human ANXA5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *
0
Inquiry Basket