Recombinant Mouse Anxa5 Protein, His-tagged

Cat.No. : Anxa5-7163M
Product Overview : Recombinant mouse Anxa5, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-319
Description : This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Form : Liquid
Molecular Mass : 38.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSPMGSMATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by bradford assay)
Storage Buffer : Phosphate Buffered Saline containing 10 % glycerol, 1 mM DTT.
Gene Name Anxa5 annexin A5 [ Mus musculus (house mouse) ]
Official Symbol Anxa5
Synonyms Anxa5; annexin A5; An; Anx5; R74653; annexin A5; CBP-I; PAP-I; PP4; VAC-alpha; anchorin CII; annexin V; annexin-5; calphobindin I; endonexin II; lipocortin V; placental anticoagulant protein 4; placental anticoagulant protein I; thromboplastin inhibitor; vascular anticoagulant-alpha
Gene ID 11747
mRNA Refseq NM_009673
Protein Refseq NP_033803
UniProt ID P48036

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Anxa5 Products

Required fields are marked with *

My Review for All Anxa5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon