Recombinant Mouse Anxa5 Protein, His-tagged
Cat.No. : | Anxa5-7163M |
Product Overview : | Recombinant mouse Anxa5, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-319 |
Description : | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. |
Form : | Liquid |
Molecular Mass : | 38.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSPMGSMATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by bradford assay) |
Storage Buffer : | Phosphate Buffered Saline containing 10 % glycerol, 1 mM DTT. |
Gene Name | Anxa5 annexin A5 [ Mus musculus (house mouse) ] |
Official Symbol | Anxa5 |
Synonyms | Anxa5; annexin A5; An; Anx5; R74653; annexin A5; CBP-I; PAP-I; PP4; VAC-alpha; anchorin CII; annexin V; annexin-5; calphobindin I; endonexin II; lipocortin V; placental anticoagulant protein 4; placental anticoagulant protein I; thromboplastin inhibitor; vascular anticoagulant-alpha |
Gene ID | 11747 |
mRNA Refseq | NM_009673 |
Protein Refseq | NP_033803 |
UniProt ID | P48036 |
◆ Recombinant Proteins | ||
ANXA5-347R | Recombinant Rat ANXA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANXA5-2624H | Recombinant Human Annexin A5, Biotin | +Inquiry |
ANXA5-1071H | Recombinant Human ANXA5 protein, GST-tagged | +Inquiry |
ANXA5-3182C | Recombinant Chicken ANXA5 | +Inquiry |
ANXA5-0429H | Recombinant Human ANXA5 Protein (Met1-Asp320), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Anxa5 Products
Required fields are marked with *
My Review for All Anxa5 Products
Required fields are marked with *
0
Inquiry Basket