Recombinant Human APOD protein, GST-tagged
Cat.No. : | APOD-707H |
Product Overview : | Human APOD full-length ORF (BAG35026.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 47.19 kDa |
AA Sequence : | MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOD apolipoprotein D [ Homo sapiens ] |
Official Symbol | APOD |
Synonyms | APOD; apolipoprotein D; apo-D; |
Gene ID | 347 |
mRNA Refseq | NM_001647 |
Protein Refseq | NP_001638 |
MIM | 107740 |
UniProt ID | P05090 |
◆ Recombinant Proteins | ||
APOD-1884C | Recombinant Chicken APOD | +Inquiry |
APOD-725R | Recombinant Rat APOD Protein | +Inquiry |
APOD-707H | Recombinant Human APOD protein, GST-tagged | +Inquiry |
APOD-363H | Recombinant Human APOD Protein, His (Fc)-Avi-tagged | +Inquiry |
APOD-381R | Recombinant Rat APOD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOD-8781HCL | Recombinant Human APOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOD Products
Required fields are marked with *
My Review for All APOD Products
Required fields are marked with *
0
Inquiry Basket